Loading...
Statistics
Advertisement

group galore | Digitale Publikums- und Standortföderung
www.group-galore.com/

Group-galore.com

Advertisement
Conversion Technology Metas Server
Group-galore.com is hosted in Germany / Berlin . Group-galore.com doesn't use HTTPS protocol. Number of used technologies: 8. First technologies: CSS, Html, Html5, Number of used javascripts: 12. First javascripts: Jquery.js, Jquery-migrate.min.js, Ajax.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Number of used plugins, modules: 4. Its server type is: Apache/2.2.31 (Unix). Its CMS is: Wordpress.

Technologies in use by Group-galore.com

Technology

Number of occurences: 8
  • CSS
  • Html
  • Html5
  • Javascript
  • jQuery
  • Php
  • Pingback
  • Revslider

Advertisement

Javascripts

Number of occurences: 12
  • jquery.js
  • jquery-migrate.min.js
  • ajax.js
  • jquery.themepunch.tools.min.js
  • jquery.themepunch.revolution.min.js
  • x-head.min.js
  • cs-head.min.js
  • x-body.min.js
  • x-icon.min.js
  • comment-reply.min.js
  • cs-body.min.js
  • nicescroll.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Apache/2.2.31 (Unix)

Powered by

  • PHP/5.3.29

Used plugins, modules

Number of plugins and modules: 4
  • newsletter2go
  • revslider
  • cornerstone
  • x smooth scroll

Google Analytics ID

  • UA-27173257-1

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Group-galore.com

Missing HTTPS protocol.

    Meta - Group-galore.com

    Number of occurences: 3
    • Name:
      Content:
    • Name: viewport
      Content: width=device-width, initial-scale=1.0
    • Name: generator
      Content: Powered by Slider Revolution 5.2.5.1 - responsive, Mobile-Friendly Slider Plugin for WordPress with comfortable drag and drop interface.

    Server / Hosting

    • IP: 81.169.145.91
    • Latitude: 52.52
    • Longitude: 13.40
    • Country: Germany
    • City: Berlin

    Rname

    • docks14.rzone.de
    • shades09.rzone.de
    • smtp.rzone.de

    Target

    • hostmaster.strato-rz.de

    HTTP Header Response

    HTTP/1.1 301 Moved Permanently Date: Tue, 10 May 2016 17:34:19 GMT Server: Apache/2.2.31 (Unix) X-Powered-By: PHP/5.3.29 X-Pingback: http://www.group-galore.com/xmlrpc.php Location: http://www.group-galore.com/ Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_xt40 X-Cache-Lookup: MISS from s_xt40:80 Via: 1.1 s_xt40 (squid/3.5.14) Connection: keep-alive HTTP/1.1 200 OK Date: Tue, 10 May 2016 17:34:20 GMT Server: Apache/2.2.31 (Unix) X-Powered-By: PHP/5.3.29 X-Pingback: http://www.group-galore.com/xmlrpc.php Link: ; rel=shortlink Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_xt40 X-Cache-Lookup: MISS from s_xt40:80 Via: 1.1 s_xt40 (squid/3.5.14) Connection: keep-alive

    DNS

    host: group-galore.com
    1. class: IN
    2. ttl: 150
    3. type: A
    4. ip: 81.169.145.91
    host: group-galore.com
    1. class: IN
    2. ttl: 150
    3. type: NS
    4. target: docks14.rzone.de
    host: group-galore.com
    1. class: IN
    2. ttl: 150
    3. type: NS
    4. target: shades09.rzone.de
    host: group-galore.com
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: shades09.rzone.de
    5. rname: hostmaster.strato-rz.de
    6. serial: 2016032402
    7. refresh: 86400
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 7200
    host: group-galore.com
    1. class: IN
    2. ttl: 150
    3. type: MX
    4. pri: 5
    5. target: smtp.rzone.de
    host: group-galore.com
    1. class: IN
    2. ttl: 150
    3. type: AAAA
    4. ipv6: 2a01:238:20a:202:1091::

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.roup-galore.com, www.gsroup-galore.com, www.sroup-galore.com, www.gxroup-galore.com, www.xroup-galore.com, www.gyroup-galore.com, www.yroup-galore.com, www.ghroup-galore.com, www.hroup-galore.com, www.gnroup-galore.com, www.nroup-galore.com, www.gcroup-galore.com, www.croup-galore.com, www.gdroup-galore.com, www.droup-galore.com, www.geroup-galore.com, www.eroup-galore.com, www.grroup-galore.com, www.rroup-galore.com, www.gtroup-galore.com, www.troup-galore.com, www.gbroup-galore.com, www.broup-galore.com, www.gvroup-galore.com, www.vroup-galore.com, www.goup-galore.com, www.grioup-galore.com, www.gioup-galore.com, www.grooup-galore.com, www.gooup-galore.com, www.grloup-galore.com, www.gloup-galore.com, www.grloup-galore.com, www.gloup-galore.com, www.gr.oup-galore.com, www.g.oup-galore.com, www.grup-galore.com, www.grobup-galore.com, www.grbup-galore.com, www.grohup-galore.com, www.grhup-galore.com, www.grogup-galore.com, www.grgup-galore.com, www.grojup-galore.com, www.grjup-galore.com, www.gromup-galore.com, www.grmup-galore.com, www.gro up-galore.com, www.gr up-galore.com, www.grovup-galore.com, www.grvup-galore.com, www.grop-galore.com, www.grouwp-galore.com, www.growp-galore.com, www.grouep-galore.com, www.groep-galore.com, www.grousp-galore.com, www.grosp-galore.com, www.grouap-galore.com, www.groap-galore.com, www.grou-galore.com, www.groupi-galore.com, www.groui-galore.com, www.groupk-galore.com, www.grouk-galore.com, www.groupu-galore.com, www.grouu-galore.com, www.groupj-galore.com, www.grouj-galore.com, www.groupl-galore.com, www.groul-galore.com, www.groupgalore.com, www.group-tgalore.com, www.grouptgalore.com, www.group-ggalore.com, www.groupggalore.com, www.group-hgalore.com, www.grouphgalore.com, www.group-ugalore.com, www.groupugalore.com, www.group-jgalore.com, www.groupjgalore.com, www.group-xgalore.com, www.groupxgalore.com, www.group-sgalore.com, www.groupsgalore.com, www.group-agalore.com, www.groupagalore.com, www.group-galore.com, www.groupgalore.com, www.group- galore.com, www.group galore.com, www.group-alore.com, www.group-gsalore.com, www.group-salore.com, www.group-gxalore.com, www.group-xalore.com, www.group-gyalore.com, www.group-yalore.com, www.group-ghalore.com, www.group-halore.com, www.group-gnalore.com, www.group-nalore.com, www.group-gcalore.com, www.group-calore.com, www.group-gdalore.com, www.group-dalore.com, www.group-gealore.com, www.group-ealore.com, www.group-gralore.com, www.group-ralore.com, www.group-gtalore.com, www.group-talore.com, www.group-gbalore.com, www.group-balore.com, www.group-gvalore.com, www.group-valore.com, www.group-glore.com, www.group-gaolore.com, www.group-golore.com, www.group-gaplore.com, www.group-gplore.com, www.group-ga9lore.com, www.group-g9lore.com, www.group-galore.com, www.group-glore.com, www.group-gailore.com, www.group-gilore.com, www.group-gaulore.com, www.group-gulore.com, www.group-gaore.com, www.group-galuore.com, www.group-gauore.com, www.group-gal8ore.com, www.group-ga8ore.com, www.group-gal9ore.com, www.group-ga9ore.com, www.group-galjore.com, www.group-gajore.com, www.group-gal0ore.com, www.group-ga0ore.com, www.group-galmore.com, www.group-gamore.com, www.group-galpore.com, www.group-gapore.com, www.group-galoore.com, www.group-gaoore.com, www.group-galre.com, www.group-galobre.com, www.group-galbre.com, www.group-galohre.com, www.group-galhre.com, www.group-galogre.com, www.group-galgre.com, www.group-galojre.com, www.group-galjre.com, www.group-galomre.com, www.group-galmre.com, www.group-galo re.com, www.group-gal re.com, www.group-galovre.com, www.group-galvre.com,

    Other websites we recently analyzed

    1. villa-service.de
      Dublin (Ireland) - 54.75.245.178
      Server software:
      Technology: CSS, Html
    2. Home
      Fine Art by Ed Lax
      United Kingdom - 78.110.160.2
      Server software: Apache
      Technology: CSS, Flexslider, Google Font API, Html, Html5, Javascript, jQuery Fancybox, Php, Google Analytics
      Number of Javascript: 22
      Number of meta tags: 4
    3. Mainstagebingo | Home
      Curacao - 190.121.210.6
      Server software: CXLWS
      Technology: CSS, Html, Html5, Javascript, jQuery Cookie, jQuery UI, Php, Swf Object, Google Analytics
      Number of Javascript: 15
      Number of meta tags: 1
    4. Lilabat.com Gros oeuvre & Bâtiment
      France - 213.186.33.40
      Server software: Apache
      Technology: CSS, Google Font API, Html, Html5, Wordpress
      Number of meta tags: 2
    5. Outdoor Bunting | Cheap union jack, birthday bunting for celebrations and lots more
      Germany - 82.165.184.170
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript, Php, Pingback, Wordpress
      Number of meta tags: 3
    6. ippodromolamauramilano.info
      Registrazione e gestione dei domini Internet, i documenti necessari, le ultime estensioni possibili, il listino prezzi completo!
      Italy - 195.110.124.188
      Server software: Apache
      Technology: Html
      Number of meta tags: 3
    7. no-win-no-fee-lawyers.com.au
      Australia - 27.121.64.40
      Server software: Apache/2.2.31 (Unix) mod_ssl/2.2.31 OpenSSL/1.0.1e-fips mod_bwlimited/1.4
      Technology: Html
      Number of meta tags: 1
    8. antarvedisrilakshminarasimhaswamy.org
      See related links to what you are looking for.
      New York (United States) - 199.59.243.120
      Server software: Microsoft-IIS/7.5
      Technology: Google Adsense, Html, Html5, Javascript
      Number of meta tags: 3
    9. wwwpromdresses.com
      New York (United States) - 69.172.201.208
      Server software: DOSarrest
      Technology: Html, Javascript
      Number of meta tags: 1
    10. Concept Egypt reale state - Concept Egypt realestate
      Joomla! - the dynamic portal engine and content management system
      Scottsdale (United States) - 107.180.51.2
      Server software: Apache/2.4.23
      Technology: CSS, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, jQuery Cycle, jQuery UI, Php, Joomla
      Number of Javascript: 30
      Number of meta tags: 7

    Check Other Websites